Transcript | Ll_transcript_431399 |
---|---|
CDS coordinates | 85-636 (+) |
Peptide sequence | MEKVASQLHRRSSVSSDVQNYDAAFRRPAVYQRRSFGNYSNAALQYPLMPSCGATSDLSSVATASPVFVAAPAEKGHFLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFKRTTAEEGVVALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFA |
ORF Type | 3prime_partial |
Blastp | ADP,ATP carrier protein 1, mitochondrial from Gossypium with 76.14% of identity |
---|---|
Blastx | ADP,ATP carrier protein 1, mitochondrial from Gossypium with 76.14% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | egu-MIR172e (MI0020571) |
Ncbi protein | Link to NCBI protein (XP_019449581.1) |
Pfam | Mitochondrial carrier protein (PF00153.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer