Transcript | Ll_transcript_317020 |
---|---|
CDS coordinates | 1-579 (+) |
Peptide sequence | YIFLASSFFPLLLTKMTTSISLTLFFFLFILISIPSSHCRTLEINNESLIVNTCNKTPDANLCIRSIKSRPGSATANLTGLSEISIDVLHFQVNNILNKIHDLQSAGTEPKQGLDFCEKKYTTMKEVDIPKALQALKSGDGKGAEDVVKGDVELAMNCEKQSRGLLTSLNQFVRDVANVAQSIARQLYTKKH* |
ORF Type | 5prime_partial |
Blastp | Cell wall / vacuolar inhibitor of fructosidase 1 from Arabidopsis with 35.25% of identity |
---|---|
Blastx | Cell wall / vacuolar inhibitor of fructosidase 1 from Arabidopsis with 35.25% of identity |
Eggnog | cell wall vacuolar inhibitor of fructosidase(ENOG41113RP) |
Kegg | Link to kegg annotations (AT1G47960) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431177.1) |
Pfam | Plant invertase/pectin methylesterase inhibitor (PF04043.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer