Protein coding transcript 117343

• Transcript: Ll_transcript_430102
• CDS coordinates: 134-1339 (+)
• Peptide sequence: MIVLQIKSGLFTGCLLALLAGYVIMAHVTGLYRPQQHSVYMETVYPVLSMFSLMFLHFFLYGCNILAWRKTRINYSFIFELAPTKDLKYGDIFLICTMAMTTVIGVIFLHLTLLTKGYSSAQVQDIPGLLLLVFLLMLVCPFNIIYRSSRYRFLCVIRNIILSPLYKVVMLDFFMADQLCSQVPMIRNLEYVACYYITGSYKTQDYGYCMRTKHYRDLAYAVSFLPYYWRAMQCARRWFEEGQTSHLVNLGKYVSAMLAAGAKVAYEKDGSVVWLCLVVIMSSAATMYQLYWDFVKDWGLLQINSKNPWLRNELMLHRKTIYYFSMGLNLILRLAWLQTVLHSSFENVDYRVTSLFLAALEVIRRGLWNFYRLENEHVNNAGKFRAVKTVPLPFDEVDEEE*
• ORF Type: complete

Annotations of Ll_transcript_430102

• Blastp: Phosphate transporter PHO1 homolog 1 from Arabidopsis with 79.8% of identity
• Blastx: Phosphate transporter PHO1 homolog 1 from Arabidopsis with 79.8% of identity
• Eggnog: Xenotropic and polytropic retrovirus receptor 1(COG5409)
• Kegg: Link to kegg annotations (AT1G68740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454566.1)
• Pfam: EXS family (PF03124.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;