Protein coding transcript 117398

• Transcript: Ll_transcript_429168
• CDS coordinates: 202-1797 (+)
• Peptide sequence: MLKLILSSSAHRLPQTVVPTLRPATLSTSPLHKVLGSLRGGRLFFCSGSGDGADAEAKVVESGSGVEESQTKASSAIVSTNPRPEDYLTVLALPLLHRPLFPGFYMPIYVKDPKLLAALQESRERQAPYAGAFLLKDEPGSDPSVVTGSDTDKNVYDLKGKELFNRLHEVGTLAQISSIHGDQVILIGHRRLRIAEMVSEDPLTVKVDHLKDKAYNKDDDMIKATSSEVISTLRDVLKTSSLWRDHVQTYTKHIGDFTPPRIADFGAAISGANKLQCQQVLEELDVYNRLKLTLELVKKEMEISKIQESIAKAIEEKISGEQRRYLLNEQLKAIKKELGLETDDKTALTGKFRERIEPKREKCPHHVLQVIDEELTKLQLLEASSSEFSVTRNYLDWLTALPWGEYSDENFDVTRAQKILDEDHYGLTDVKDRILEFIAVGKLRGTSQGKIICLSGPPGVGKTSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDKVRHC*
• ORF Type: complete

Annotations of Ll_transcript_429168

• Blastp: Lon protease homolog, mitochondrial from Zea with 78.25% of identity
• Blastx: Lon protease homolog, mitochondrial from Zea with 78.25% of identity
• Eggnog: ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short-lived regulatory proteins. Required for cellular homeostasis and for survival from DNA damage and developmental changes induced by stress. Degrades polypeptides processively to yield small peptide fragments that are 5 to 10 amino acids long. Binds to DNA in a double-stranded, site-specific manner (By similarity)(COG0466)
• Kegg: Link to kegg annotations (732810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428611.1)
• Pfam: ATP-dependent protease La (LON) substrate-binding domain (PF02190.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;