Transcript | Ll_transcript_430498 |
---|---|
CDS coordinates | 2-919 (+) |
Peptide sequence | GEGVFVLIRMEFSSVQNLCLHLISSAYQRCRLSEHICRLSIILARSSSSLPSSLRVSISDTGIGSCLEEYQYLKLSSTVVADNWDGVLSIKTTSISDSEIHNYQIILKENGSPRITSLPSNPKKGAIFSGSEVCLCPSVSLDLLLAEVYSFLQKNVAIQLVAEDCAVPGSQYEKVFLANECTQLPISGSNPELLKSGLKDYVLKHGNNLSNVCNSCFPSREQFKVGSGIACCTKSSQHTELVMEAVIVMSNISRENIACVREHGDKTEVLYFKDFSPCKICRSCMKALKTADWKRYGLNLRGIIQC |
ORF Type | internal |
Blastp | Type 2 DNA topoisomerase 6 subunit B-like from Arabidopsis with 43% of identity |
---|---|
Blastx | Type 2 DNA topoisomerase 6 subunit B-like from Arabidopsis with 43% of identity |
Eggnog | NA(ENOG410YF05) |
Kegg | Link to kegg annotations (AT1G60460) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445722.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer