Protein coding transcript 117506

• Transcript: Ll_transcript_430498
• CDS coordinates: 2-919 (+)
• Peptide sequence: GEGVFVLIRMEFSSVQNLCLHLISSAYQRCRLSEHICRLSIILARSSSSLPSSLRVSISDTGIGSCLEEYQYLKLSSTVVADNWDGVLSIKTTSISDSEIHNYQIILKENGSPRITSLPSNPKKGAIFSGSEVCLCPSVSLDLLLAEVYSFLQKNVAIQLVAEDCAVPGSQYEKVFLANECTQLPISGSNPELLKSGLKDYVLKHGNNLSNVCNSCFPSREQFKVGSGIACCTKSSQHTELVMEAVIVMSNISRENIACVREHGDKTEVLYFKDFSPCKICRSCMKALKTADWKRYGLNLRGIIQC
• ORF Type: internal

Annotations of Ll_transcript_430498

• Blastp: Type 2 DNA topoisomerase 6 subunit B-like from Arabidopsis with 43% of identity
• Blastx: Type 2 DNA topoisomerase 6 subunit B-like from Arabidopsis with 43% of identity
• Eggnog: NA(ENOG410YF05)
• Kegg: Link to kegg annotations (AT1G60460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445722.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;