Protein coding transcript 117508

• Transcript: Ll_transcript_430466
• CDS coordinates: 560-874 (+)
• Peptide sequence: MELINTRPCFDIEFDSGYLAPEYAMGGQLTMKADVYSFGVLILEIVSGKSSARANWGGSQKFLLEWAWQLHEEGKLLELVDPDMVEYPEEEVIRHMKVAFFCTQA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_430466

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At1g56140 from Arabidopsis with 52.27% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At1g56140 from Arabidopsis with 52.27% of identity
• Eggnog: (E 0.0) leucine-rich repeat family protein protein kinase family protein(ENOG410XSG4)
• Kegg: Link to kegg annotations (AT1G56140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004505039.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;