Protein coding transcript 117509

• Transcript: Ll_transcript_430468
• CDS coordinates: 2-520 (+)
• Peptide sequence: GEGVFVLIRMEFSSVQNLCLHLISSAYQRCRLSEHICRLSIILARSSSSLPSSLRVSISDTGIGSCLEEYQYLKLSSTVVADNWDGVLSIKTTSISDSEIHNYQIILKENGSPRITSLPSNPKKGAIFSGSEVCLCPSVSLDLLLAEVYSFLQKVCLLFCATSSNHFVAHCS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_430468

• Blastp: Type 2 DNA topoisomerase 6 subunit B-like from Arabidopsis with 45.95% of identity
• Blastx: Type 2 DNA topoisomerase 6 subunit B-like from Arabidopsis with 39.51% of identity
• Eggnog: NA(ENOG410YF05)
• Kegg: Link to kegg annotations (AT1G60460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445722.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;