| Transcript | Ll_transcript_430469 |
|---|---|
| CDS coordinates | 2-319 (+) |
| Peptide sequence | GEGVFVLIRMEFSSVQNLCLHLISSAYQRCRLSEHICRLSIILARSSSSLPSSLRVSISDTGIGSCLEEYQYLKLSSTVVADNWADGVLSIKPTSEFNFLIVVLL* |
| ORF Type | 5prime_partial |
| Blastp | Type 2 DNA topoisomerase 6 subunit B-like from Arabidopsis with 47.56% of identity |
|---|---|
| Blastx | Type 2 DNA topoisomerase 6 subunit B-like from Arabidopsis with 47.56% of identity |
| Eggnog | NA(ENOG410YF05) |
| Kegg | Link to kegg annotations (AT1G60460) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019445722.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer