Transcript | Ll_transcript_322250 |
---|---|
CDS coordinates | 235-576 (+) |
Peptide sequence | MMKSSLSSPTVYASGKVIIITLLAILFIFFVSSVNCRLPSPLLPSPTSSRNNNLQRYYCDSFSKRNLRSLCMQLQRIHSNLQPFPLPPKANGIDPRYGEQKRLVPSGPNPLHN* |
ORF Type | complete |
Blastp | CLAVATA3/ESR (CLE)-related protein 9 from Arabidopsis with 63.16% of identity |
---|---|
Blastx | CLAVATA3/ESR (CLE)-related protein 9 from Arabidopsis with 63.16% of identity |
Eggnog | clavata3 esr-related(ENOG41112ZV) |
Kegg | Link to kegg annotations (AT1G26600) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020218054.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer