Protein coding transcript 117636

• Transcript: Ll_transcript_431579
• CDS coordinates: 315-821 (+)
• Peptide sequence: MASVSTQPQFRYTQTPSKVLHLRNLPWECTEEELIELGKPFGKVVNTKCNVGANRNQAFIEFQDLNQAIAMISYYASSSDPAQVRGKTVYLQYSNRQEIVNNKTAADVAGNVLLVTIEGEDARLVSIDVLHLVFSAFGFVHKITNFEKTAGFQALVQFSDEPTATSAKD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_431579

• Blastp: Polypyrimidine tract-binding protein homolog 2 from Arabidopsis with 89.88% of identity
• Blastx: Polypyrimidine tract-binding protein homolog 2 from Arabidopsis with 89.88% of identity
• Eggnog: polypyrimidine tract binding protein(ENOG410XPMZ)
• Kegg: Link to kegg annotations (AT5G53180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437395.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;