Protein coding transcript 117668

• Transcript: Ll_transcript_430917
• CDS coordinates: 1001-1573 (+)
• Peptide sequence: MEKSEEEFQGYLNDFALAVWTLLGNVSQLSSRDRLAITAIKFLTTVSTSVHHALFADDRVIPQICQGIVIPNVRLREDDEELFEMNYIEFIRRDMEGSDLDTRRRIACELLKGIAMHYGDAVRSIVSAQIQNLLSSFAANPGENWKDKDCAIYLVVSLATKKAGSSYVSTELVDVQSFFESVSLSCKVQM*
• ORF Type: complete

Annotations of Ll_transcript_430917

• Blastp: Exportin-2 from Arabidopsis with 72.43% of identity
• Blastx: Exportin-2 from Arabidopsis with 65.96% of identity
• Eggnog: Importin(COG5657)
• Kegg: Link to kegg annotations (AT2G46520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459402.1)
• Pfam: Cse1 (PF08506.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;