Transcript | Ll_transcript_430912 |
---|---|
CDS coordinates | 771-1343 (+) |
Peptide sequence | MEKSEEEFQGYLNDFALAVWTLLGNVSQLSSRDRLAITAIKFLTTVSTSVHHALFADDRVIPQICQGIVIPNVRLREDDEELFEMNYIEFIRRDMEGSDLDTRRRIACELLKGIAMHYGDAVRSIVSAQIQNLLSSFAANPGENWKDKDCAIYLVVSLATKKAGSSYVSTELVDVQSFFESVSLSCKVQM* |
ORF Type | complete |
Blastp | Exportin-2 from Arabidopsis with 72.43% of identity |
---|---|
Blastx | Exportin-2 from Arabidopsis with 63.45% of identity |
Eggnog | Importin(COG5657) |
Kegg | Link to kegg annotations (AT2G46520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459402.1) |
Pfam | Cse1 (PF08506.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer