Protein coding transcript 117770

• Transcript: Ll_transcript_429738
• CDS coordinates: 890-1441 (+)
• Peptide sequence: MLLHMGGQNLARPTGPSANDLSRALLDRFSTVDLKLKLQLYKVQFLLLTRNLKLAKREVKLVMNIARGRDSSMALLLKSQLEYARGNHCKAIKLLMASSNRTDTAFSSIFNNNLGCIYYHLGKYHTSSLFFSKALTNSSSMRKDQPLKLTTFSQDNSFLIIYNCGVQYLACGKPILAASCFQKA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_429738

• Blastp: CCR4-NOT transcription complex subunit 10 from Danio with 33.16% of identity
• Blastx: CCR4-NOT transcription complex subunit 10 from Danio with 33.16% of identity
• Eggnog: Ccr4-NOT transcription complex, subunit(ENOG410XQQJ)
• Kegg: Link to kegg annotations (449918)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464222.1)
• Pfam: Tetratricopeptide repeat (PF13181.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;