Protein coding transcript 117772

• Transcript: Ll_transcript_429308
• CDS coordinates: 411-1298 (+)
• Peptide sequence: MGVHTQTLSTFDLNSNPSFPYSTVNGIHRPTSPLANDQPLKTSNVESPECHAPSRAWHQDTAAVRVQKVYRSYRTRRRLADSAVVAEELWWQAIDFVRLNRSTISFFNLPETAASRWARVILNASKVGKGLSVDAKAQKLAFQHWIEAIDPRHRYGHNLHYYYEEWCKTDADEPFFYWLDLGKGKNLDLEKCPRSKLRKQCIKYLGPQEREHYEYIVCEGKIIHKYSGDVLHTKEGSEDAKWIFVMSTSKKLYAGKKKKGSFHHSSFLAGGATLAAGRLEAEHGTLKVKLTSEVA*
• ORF Type: complete

Annotations of Ll_transcript_429308

• Blastp: IQ domain-containing protein IQM3 from Arabidopsis with 65.96% of identity
• Blastx: IQ domain-containing protein IQM3 from Arabidopsis with 64.49% of identity
• Eggnog: NA(ENOG410XYBD)
• Kegg: Link to kegg annotations (AT3G52870)
• CantataDB: Link to cantataDB annotations (CNT0001147)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417633.1)
• Pfam: IQ calmodulin-binding motif (PF00612.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;