Protein coding transcript 117777

• Transcript: Ll_transcript_429313
• CDS coordinates: 411-947 (+)
• Peptide sequence: MGVHTQTLSTFDLNSNPSFPYSTVNGIHRPTSPLANDQPLKTSNVESPECHAPSRAWHQDTAAVRVQKVYRSYRTRRRLADSAVVAEELWWQAIDFVRLNRSTISFFNLPETAASRWARVILNASKVGKGLSVDAKAQKLAFQHWIEAIDPRHRYGHNLHYYYEEWCKTDADEPFFYW*
• ORF Type: complete

Annotations of Ll_transcript_429313

• Blastp: IQ domain-containing protein IQM3 from Arabidopsis with 70.8% of identity
• Blastx: IQ domain-containing protein IQM3 from Arabidopsis with 62.71% of identity
• Eggnog: NA(ENOG410XYBD)
• Kegg: Link to kegg annotations (AT3G52870)
• CantataDB: Link to cantataDB annotations (CNT0001189)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417633.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;