Protein coding transcript 117886

• Transcript: Ll_transcript_430316
• CDS coordinates: 3-545 (+)
• Peptide sequence: LSHFLTLSSCRRKMIKLRLKRFSRSSSKISNGKKASPLEDKDCGEIEWELRPGGMLVQKRERNNLGEGMITIRVSTMSQLHDISIHATSTFGMSQLIPFSSSNDYANICHMHVRRLEPREQRLLFKGKERDDNEFLHMIGVRDKDKVLLLEDPAIKEKKKLLGIARDQPINNLCCTTIIV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_430316

• Blastp: BAG family molecular chaperone regulator 2 from Arabidopsis with 38.02% of identity
• Blastx: BAG family molecular chaperone regulator 2 from Arabidopsis with 38.02% of identity
• Eggnog: BCL-2-associated athanogene(ENOG4111WNH)
• Kegg: Link to kegg annotations (AT5G62100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426906.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;