Protein coding transcript 1179

• Transcript: Ll_transcript_322221
• CDS coordinates: 2-358 (+)
• Peptide sequence: SVGASPEIIQMAEKIIIEVNTASPDLTGLHDIVGTDVPPYKKPYLVMSPEDRIGLPYIPVDPEKVVAIVESNYMDQTQPNAAEDETSRKIASNLVEFLQHEVKHGRLPANLTPVQSGIG
• ORF Type: internal

Annotations of Ll_transcript_322221

• Blastp: Acetyl-CoA hydrolase from Neurospora with 60.55% of identity
• Blastx: Acetyl-CoA hydrolase from Neurospora with 62.18% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (NCU09770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004514912.1)
• Pfam: Acetyl-CoA hydrolase/transferase N-terminal domain (PF02550.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;