Protein coding transcript 117940

• Transcript: Ll_transcript_430241
• CDS coordinates: 76-957 (+)
• Peptide sequence: MSSFSASNNLTSSLSPTLSPHRYPTRPSSFICLHHQPSSNDSQHQHSPFKSLSRTVAISSSSAAAAVIFHSTPLIEFPTDFSLGGGNNGGVGSGGGGGGGWFGGGGGGDGDGGLWSRLFASGSAIADESQSQDWDSHGLPTNIVVQLNKLSGFKKYKLSEILFFDRNRRSKVSSEDSFFEMVSLRPGGVYTKAQLQKELETLATCGMFEKVDLEGKTNADGTIGVTINFTESTWQQADRFRCINVGLMQQTKPVEMDSDMTDKEMLEYYRTQERDYKRRIERAKPCLLPGSVQ*
• ORF Type: complete

Annotations of Ll_transcript_430241

• Blastp: Protein TOC75-3, chloroplastic from Arabidopsis with 78.65% of identity
• Blastx: Protein TOC75-3, chloroplastic from Arabidopsis with 76.63% of identity
• Eggnog: Gram-negative-bacterium-type cell outer membrane assembly(COG4775)
• Kegg: Link to kegg annotations (AT3G46740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458364.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;