Transcript | Ll_transcript_430234 |
---|---|
CDS coordinates | 76-957 (+) |
Peptide sequence | MSSFSASNNLTSSLSPTLSPHRYPTRPSSFICLHHQPSSNDSQHQHSPFKSLSRTVAISSSSAAAAVIFHSTPLIEFPTDFSLGGGNNGGVGSGGGGGGGWFGGGGGGDGDGGLWSRLFASGSAIADESQSQDWDSHGLPTNIVVQLNKLSGFKKYKLSEILFFDRNRRSKVSSEDSFFEMVSLRPGGVYTKAQLQKELETLATCGMFEKVDLEGKTNADGTIGVTINFTESTWQQADRFRCINVGLMQQTKPVEMDSDMTDKEMLEYYRTQERDYKRRIERAKPCLLPGSVQ* |
ORF Type | complete |
Blastp | Protein TOC75-3, chloroplastic from Arabidopsis with 78.65% of identity |
---|---|
Blastx | Protein TOC75-3, chloroplastic from Arabidopsis with 88.02% of identity |
Eggnog | Gram-negative-bacterium-type cell outer membrane assembly(COG4775) |
Kegg | Link to kegg annotations (AT3G46740) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436590.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer