Protein coding transcript 117989

• Transcript: Ll_transcript_305587
• CDS coordinates: 141-1022 (+)
• Peptide sequence: MESWSYVEEGKGYLFSDEMDFSLDAFMRSRKALVEWDNKGSCNFEGDGFASDREVVLEFVAKEGIHPKEGQQSMEFVDLGFPDLFRKSFNSGHAHEISSCELDSNSSKRGNSSTHVIALVSSLGEEVSESKHLSSLVESKTDGSSLIDLKLGRLAECQGSSNDEITEGFTLSSIHPTVFTKRARTSSSPILAPVCQVYGCNMDLSSSKEYHKRHKVCDVHSKTAKVIVNGIEQRFCQQCSRFHLLADFDDGKRSCRRRLAGHNERRRKHQFDYMSSKQHKIHQSFQGMKYSFC*
• ORF Type: complete

Annotations of Ll_transcript_305587

• Blastp: Squamosa promoter-binding-like protein 6 from Arabidopsis with 48.04% of identity
• Blastx: Squamosa promoter-binding-like protein 6 from Arabidopsis with 56.34% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG41120IC)
• Kegg: Link to kegg annotations (AT1G69170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428516.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;