Protein coding transcript 117997

• Transcript: Ll_transcript_305614
• CDS coordinates: 264-875 (+)
• Peptide sequence: MVSAWGGYVFIINLVPLYVLVLLVTGRYSMRLYVAYNCMYVLGMLLAMQIRFVGFQHVQSGEHMAAMGVFFLLQVFFFLDWVKHLLSDTKLFQAFLRITVTGAVGVGAIALGIGTATGFISPWTGRFYSLLDPTYAKDHIPIIASVSEHQPTAWSSFMFDFHILMFLFPAGLYFCFKRLSDATIFIVMYGLTSMYFAGVMVRLI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_305614

• Blastp: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B from Arabidopsis with 88.24% of identity
• Blastx: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B from Oryza sativa with 91.97% of identity
• Eggnog: oligosaccharyl transferase STT3 subunit(COG1287)
• Kegg: Link to kegg annotations (AT1G34130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436790.1)
• Pfam: Oligosaccharyl transferase STT3 subunit (PF02516.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;