Transcript | Ll_transcript_305878 |
---|---|
CDS coordinates | 2-367 (+) |
Peptide sequence | NKPADYDSDDEYINPRQQARQPLLNKPAGPATGVPVAGTIDQRPSRNDAWSTRMREKVQYYFFLLVHFINILVIGTFHMFILAGICIHVGSWFCCFIMTTNILLLTNIHMYSYIWLCLLAS* |
ORF Type | 5prime_partial |
Blastp | Tobamovirus multiplication protein 2A from Arabidopsis with 71.93% of identity |
---|---|
Blastx | Tobamovirus multiplication protein 2A from Arabidopsis with 71.93% of identity |
Eggnog | Tetraspanin family(ENOG4111KWC) |
Kegg | Link to kegg annotations (AT1G32400) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424264.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer