Protein coding transcript 118149

• Transcript: Ll_transcript_304852
• CDS coordinates: 258-566 (+)
• Peptide sequence: MERVKNRLKQKKIDLQYTQEAVELLGVLGFDPNFGARPVKRVIQQLVENEIAMGVLRGDFKEEDSIIVDADVTPSAKDPSPLNRLHIKKLDNPVADAMVAND*
• ORF Type: complete

Annotations of Ll_transcript_304852

• Blastp: Chaperone protein ClpB3, mitochondrial from Oryza sativa with 60.78% of identity
• Blastx: Chaperone protein ClpB3, mitochondrial from Oryza sativa with 61.17% of identity
• Eggnog: ATP-dependent CLP protease ATP-binding subunit(COG0542)
• Kegg: Link to kegg annotations (4328515)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437789.1)
• Pfam: C-terminal, D2-small domain, of ClpB protein (PF10431.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;