Protein coding transcript 118156

• Transcript: Ll_transcript_304819
• CDS coordinates: 203-925 (+)
• Peptide sequence: MASTTSFSGLTFPLSSHRNDARFSHFQSFLHFPHKPTSLKTLNTVPFNKREPFSIGFHGIRRIPKKFSLLCATASNGKITQQEFTEMAWQAIVSSPEVAKENKHQIVETEHLMKALLEQKNGLARRTFSKVGVDNTRLLEATDKHIQRQPKVLGDSSGSMLGRDLEALIQRARDFKKEYGDSFVSVEHLLLGFAEDKRFGKILFRDFQITLQALKSAIESIRGRQSVIDQGQILFLSFLY*
• ORF Type: complete

Annotations of Ll_transcript_304819

• Blastp: Chaperone protein ClpB2, chloroplastic from Oryza sativa with 82.35% of identity
• Blastx: Chaperone protein ClpB2, chloroplastic from Oryza sativa with 82.35% of identity
• Eggnog: ATP-dependent CLP protease ATP-binding subunit(COG0542)
• Kegg: Link to kegg annotations (4333161)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427992.1)
• Pfam: Clp amino terminal domain, pathogenicity island component (PF02861.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;