Protein coding transcript 1182

• Transcript: Ll_transcript_322229
• CDS coordinates: 134-511 (+)
• Peptide sequence: MDMDMGLNEDEIMTCIKHETFESTKEECLENKEACSMCQVIYMNGEKLGRLYCLHKFHMECIKYWLSKKNKCPVCKRRALIANDDDDNVNNATDLDDDDGDSVTDLDDGYDCDNNDDTDSDIEDE*
• ORF Type: complete

Annotations of Ll_transcript_322229

• Blastp: Probable E3 ubiquitin-protein ligase HIP1 from Oryza sativa with 40.51% of identity
• Blastx: Probable E3 ubiquitin-protein ligase HIP1 from Oryza sativa with 40.51% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (9272591)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447288.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;