Protein coding transcript 11823

• Transcript: Ll_transcript_410881
• CDS coordinates: 142-444 (+)
• Peptide sequence: MDRLRPRNRTQFSGFTNAEIEKMEKLLMESRERSLDREFCQSLASRFNRSSGRAGKPLVKGTEIQSWFQTRLQDLPEVPNNEPVSPKDIECKEGGASCMP*
• ORF Type: complete

Annotations of Ll_transcript_410881

• Blastp: Protein SAWADEE HOMEODOMAIN HOMOLOG 2 from Arabidopsis with 61.94% of identity
• Blastx: Protein SAWADEE HOMEODOMAIN HOMOLOG 2 from Arabidopsis with 61.79% of identity
• Eggnog: HOX(ENOG410Y94E)
• Kegg: Link to kegg annotations (AT3G18380)
• CantataDB: Link to cantataDB annotations (CNT0001645)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438432.1)
• Pfam: SAWADEE domain (PF16719.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;