Transcript | Ll_transcript_410881 |
---|---|
CDS coordinates | 142-444 (+) |
Peptide sequence | MDRLRPRNRTQFSGFTNAEIEKMEKLLMESRERSLDREFCQSLASRFNRSSGRAGKPLVKGTEIQSWFQTRLQDLPEVPNNEPVSPKDIECKEGGASCMP* |
ORF Type | complete |
Blastp | Protein SAWADEE HOMEODOMAIN HOMOLOG 2 from Arabidopsis with 61.94% of identity |
---|---|
Blastx | Protein SAWADEE HOMEODOMAIN HOMOLOG 2 from Arabidopsis with 61.79% of identity |
Eggnog | HOX(ENOG410Y94E) |
Kegg | Link to kegg annotations (AT3G18380) |
CantataDB | Link to cantataDB annotations (CNT0001645) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438432.1) |
Pfam | SAWADEE domain (PF16719.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer