Transcript | Ll_transcript_306005 |
---|---|
CDS coordinates | 376-927 (+) |
Peptide sequence | MNQTWVFSLSIATILVSVVNAQSAVKPLVKIVKGKKVCDKGWECKGFSAYCCNETISDYFDTYQFENLFSKRNAPVAHATGFWDYRSFITAAAEYQPHGFGTTGNKTTGMKEVAAFLGHVGSKTSCGYGVATGGPLAWGLCYNKELSPDKYYCDDYYKLTYPCSPGAAYYGRGAIPIYWYSYF* |
ORF Type | complete |
Blastp | Chitinase-like protein 2 from Arabidopsis with 80.47% of identity |
---|---|
Blastx | Chitinase-like protein 2 from Arabidopsis with 80.47% of identity |
Eggnog | chitinase(COG3979) |
Kegg | Link to kegg annotations (AT3G16920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440177.1) |
Pfam | Chitinase class I (PF00182.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer