Protein coding transcript 118287

• Transcript: Ll_transcript_305954
• CDS coordinates: 164-553 (+)
• Peptide sequence: MAYHNQNHDLSQQEFSLHHFTNQSNSTPNWLNNTTTTTTTTTAAVNSSAQWKAEILGHPLYEQLLSAHVGCLRIATPVDQLPRIDAQLAQSEDVVAKYSNTFGPNMVAADKELDQFMVILREKIEPKKL*
• ORF Type: complete

Annotations of Ll_transcript_305954

• Blastp: Homeobox protein knotted-1-like 3 from Malus with 78.57% of identity
• Blastx: Homeobox protein knotted-1-like 3 from Malus with 78.57% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447574.1)
• Pfam: KNOX1 domain (PF03790.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;