Protein coding transcript 118334

• Transcript: Ll_transcript_305434
• CDS coordinates: 1-816 (+)
• Peptide sequence: QSMNSPSQLNWPQNGNDPCGQSWKGITCSGNRVTEIKLPGLELSGTLGYQLQSLTSLTTLDLSNNNLGGAIPYQLPPNVARLNLANNNLTGNIPFSFSDLTSLTDLNLGHNQLQQGLSFDFSRLSTLSTLDVSFNALTGDLPQSLSLLPDITSMYMQNNQFTGTINILANLPLKFLNVENNHFTGWIPEQLQNINIQAGSNAWSSGPVPPPPPGTPPAPKSNQHHKPGGGSTSHSGSDSDTSEGGKKSGIGGGGIAGILISIVVIGAIVAFF
• ORF Type: internal

Annotations of Ll_transcript_305434

• Blastp: Protein STRUBBELIG-RECEPTOR FAMILY 7 from Arabidopsis with 57.72% of identity
• Blastx: Protein STRUBBELIG-RECEPTOR FAMILY 7 from Arabidopsis with 56.1% of identity
• Eggnog: strubbelig-receptor family(ENOG410XUXK)
• Kegg: Link to kegg annotations (AT3G14350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423659.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;