Protein coding transcript 118363

• Transcript: Ll_transcript_304627
• CDS coordinates: 7843-8289 (+)
• Peptide sequence: MPDCSYFLQGLCSNRDCPYRHVNVNPKASICEGFLKGYCADGNECQKKHSYVCPTFEATRTCSHGTKCKLHHPVRQSKGKRRKRSEDQNSRRRYFGSSPIHVSEPGMMVAPRQCQPYGVIELPDYIGLGVDVDKEVAESVDQSFEQAML
• ORF Type: 3prime_partial

Annotations of Ll_transcript_304627

• Blastp: Zinc finger CCCH domain-containing protein 7 from Arabidopsis with 52.33% of identity
• Blastx: Zinc finger CCCH domain-containing protein 7 from Arabidopsis with 52.94% of identity
• Eggnog: zinc finger(COG5084)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430460.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;