Transcript | Ll_transcript_304634 |
---|---|
CDS coordinates | 7316-7744 (+) |
Peptide sequence | MFFVDGEPLSSASVPSGLTAKRAYIPRRLVIGNDEYVRIGNGNQLIRDPKKRTRKLANEKVRWSLHTARQRLTRKQKYCQFFTRFGKCNKDGGKCPYIHDPTKIAVCTKFLNGLCSTPNCTLTHKVLRNIGSKELNVVYCIY* |
ORF Type | complete |
Blastp | Zinc finger CCCH domain-containing protein 7 from Arabidopsis with 51.52% of identity |
---|---|
Blastx | Zinc finger CCCH domain-containing protein 7 from Arabidopsis with 71.09% of identity |
Eggnog | zinc finger(COG5084) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430453.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer