Protein coding transcript 118397

• Transcript: Ll_transcript_304782
• CDS coordinates: 121-672 (+)
• Peptide sequence: MLVHVQIFASDSFLELTEYTREEILGRNCRFLQGPETDMSTVDKIRDAIKEQKEITVQLINYTKSGKKFWNLFHLQPMRDQKGELQYFIGVQLDGSDHVEPLQNRLSERAELQSTKLVKATAENVDGAVRELPDANLRPEDLWAIHSQPVFPLPHKRDNPSWVAIQKIAARDGKIGLHNFAPIR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_304782

• Blastp: Phototropin-2 from Oryza sativa with 84.27% of identity
• Blastx: Phototropin-2 from Arabidopsis with 82.02% of identity
• Eggnog: Histidine kinase(COG2202)
• Kegg: Link to kegg annotations (4335426)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424317.1)
• Pfam: PAS fold (PF08447.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;