Protein coding transcript 118414

• Transcript: Ll_transcript_304692
• CDS coordinates: 106-747 (+)
• Peptide sequence: MLLKVTFLDLPLWHRILVLEILRGFCIEAHTLRILFQNFDMHPKNTNVVEGMVKALARVVSNVQVQESSEESLAAVAGMFSSKAKGIEWSLDNDASNAAVLVASEAHAITLAVEGLLGAVFTVATLTDEAIDVGELESPRGDNDPPLKWTGKTAVLCISMVDSLWLTILDALSLILSRSQGEAIVLEILKGYQAFTQACGILRAVEPLNSFLAS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_304692

• Blastp: Protein MON2 homolog from Sophophora with 26.89% of identity
• Blastx: Protein MON2 homolog from Sophophora with 26.89% of identity
• Eggnog: MON2 homolog (S. cerevisiae)(ENOG410XQA8)
• Kegg: Link to kegg annotations (Dmel_CG8683)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439975.1)
• Pfam: Guanine nucleotide exchange factor in Golgi transport N-terminal (PF12783.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;