Protein coding transcript 118432

• Transcript: Ll_transcript_304880
• CDS coordinates: 807-1415 (+)
• Peptide sequence: MGSENGLATAHGKHPLFSFGLISDVQFADIPDGRSFLGVPRYYRHSFLVLQRAVKEWNNHQRHKFVINLGDIVDGYCPKDQSLNTVKKMVDEFEMFNGPVYHLIGNHCLYNLPRSKLLPLLKIKSLRGHAYYDFSPVPEYRFVVLDGYDNSAIGWPQDHPTTLEALKFLREKNPNEDKNNPTGLVGLERRFLMFNGGIGKEQM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_304880

• Blastp: Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase from Oryza sativa with 68.97% of identity
• Blastx: Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase from Oryza sativa with 68.97% of identity
• Eggnog: Hydrolyzes cAMP to 5'-AMP. Plays an important regulatory role in modulating the intracellular concentration of cAMP, thereby influencing cAMP-dependent processes (By similarity)(COG1409)
• Kegg: Link to kegg annotations (4344352)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464576.1)
• Pfam: Calcineurin-like phosphoesterase (PF00149.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;