Protein coding transcript 118444

• Transcript: Ll_transcript_304897
• CDS coordinates: 159-1052 (+)
• Peptide sequence: MPILLSNHFSLIWIAICICGSSSIQNTARYRNTGSEPTPGAVDANNMIIFGIIQIVLSQIPNFHNIQWLSVVAAIMSLGYAFTGVGLAAVKVVENGYAEGSTKGIPASSAISKIWLVAQALGNIAFSYPFSVILIEIQDTLKSPPAENITMRKASTISVIITTFFYLCCGCAGYAAFGDDTPGNLLTGFALSKPHWLVDFANACIIIHLVGAYQVYSQPLFANFENWLRFKYPESKFVNQISLLKLPLLPVFQLNFLRLSFRTAYVASTTVVAMLFPYFNQILGVLGGIIFWPLTIYF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_304897

• Blastp: Probable amino acid permease 7 from Arabidopsis with 59.17% of identity
• Blastx: Probable amino acid permease 7 from Arabidopsis with 58.13% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT5G23810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425530.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;