Transcript | Ll_transcript_306366 |
---|---|
CDS coordinates | 194-1102 (+) |
Peptide sequence | MSHILHQRPLQTPLSHSSFSPPSSTNPKRPISLSTPTTLLALLLLILFMGLLCPWLGLMPQNIIFSVSNSYSYSSSKWGHYTLDQALNFVAKNGTVIVCIVSQPYLPFLNNWLISVTREKRQDMVLVIAEDYASLDKVNERWPGHAVLIPPVLDAENAHKFGSKGFFNFTARRPSHLLKILEHGYNVMYNDVDMVWLADPLAKLEGNHDVYFTDDMTAIKPLNHSHDLPPPGKKGRPYICSCMIFLRPTDGAKLVLKKWLEELQLQPWSRAKKSNDQPAFNWALMKTAKEVFTLFLISFQFV* |
ORF Type | complete |
Blastp | UDP-D-xylose:L-fucose alpha-1,3-D-xylosyltransferase MGP4 from Arabidopsis with 68.35% of identity |
---|---|
Blastx | UDP-D-xylose:L-fucose alpha-1,3-D-xylosyltransferase MGP4 from Arabidopsis with 68.35% of identity |
Eggnog | BEST Arabidopsis thaliana protein match is RGXT1 (rhamnogalacturonan xylosyltransferase 1)(ENOG4111Z77) |
Kegg | Link to kegg annotations (AT4G01220) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462553.1) |
Pfam | Nucleotide-diphospho-sugar transferase (PF03407.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer