| Transcript | Ll_transcript_304599 |
|---|---|
| CDS coordinates | 389-688 (+) |
| Peptide sequence | MSLKRCDIFYMQKIPKWWVWCYWITPTAWSLNGLLTSQYGDLDKEILIFGEKKQVGSFLRDYYGFRHDRLSIVAVVLIAYPIVYASLFAYCIGKMNFQKR |
| ORF Type | 3prime_partial |
| Blastp | Pleiotropic drug resistance protein 3 from Nicotiana with 67.05% of identity |
|---|---|
| Blastx | Pleiotropic drug resistance protein 3 from Nicotiana with 67.05% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (107764055) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019463336.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer