Protein coding transcript 118546

• Transcript: Ll_transcript_307183
• CDS coordinates: 3-356 (+)
• Peptide sequence: KSTGNFSAVAGSVGYIPPEYAYTMTVTMTGNVYSFGVILLELLTGKPAVTEGTELVKWVLHHSTNKDYILDFNVKRTSQAVRNQMLSVLKIALVCVSTSPEARPKMKSVLRMLLNAR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_307183

• Blastp: Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3 from Arabidopsis with 51.24% of identity
• Blastx: Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3 from Arabidopsis with 51.24% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT2G41820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461388.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;