Protein coding transcript 118552

• Transcript: Ll_transcript_307193
• CDS coordinates: 160-1245 (+)
• Peptide sequence: MRIFRKLTTPSNYHHHHQLRSYVSTCRAVVLPSFGGADKLQLRSDVPVPPLKPNHVLVRTRAVSINPLDTRMRSGYGRSIFEPLLPLILGRDVSGEVAAVGESVRSVSVGQEVFGALHPTAVRGTYTDYAILSDEEVTPKPTSLSHVEASAIPFAALTAWRALKSTARISEGQRILIVGGGGAVGFAAIQLAVAAGCNVATTCGSQSIDRILAVGAEQAVDYVAEDVELAIRGKFDAVLDTIGVPETERMGINFLKRGGHYMTLQGEAASLTDRFGLAIGLPTATAFLLKKQIQYRYSHGIEYSWTFMRADIEGLIEIRKLCEAGKLKIPVDKTFPIAQVKEAHEAKDNKLIPGKVVLELD*
• ORF Type: complete

Annotations of Ll_transcript_307193

• Blastp: Reticulon-4-interacting protein 1 homolog, mitochondrial from Danio with 35.22% of identity
• Blastx: Reticulon-4-interacting protein 1, mitochondrial from Bos with 33.9% of identity
• Eggnog: alcohol dehydrogenase(COG0604)
• Kegg: Link to kegg annotations (393323)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443914.1)
• Pfam: Alcohol dehydrogenase GroES-like domain (PF08240.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;