Transcript | Ll_transcript_307194 |
---|---|
CDS coordinates | 160-903 (+) |
Peptide sequence | MRIFRKLTTPSNYHHHHQLRSYVSTCRAVVLPSFGGADKLQLRSDVPVPPLKPNHVLVRTRAVSINPLDTRMRSGYGRSIFEPLLPLILGRDVSGEVAAVGESVRSVSVGQEVFGALHPTAVRGTYTDYAILSDEEVTPKPTSLSHVEASAIPFAALTAWRALKSTARISEGQRILIVGGGGAVGFAAIQLAVAAGCNVATTCGSQSIDRILAVGAEQAVDYVAEVVMNLFVSYLNYERQCCYCLLC* |
ORF Type | complete |
Blastp | Reticulon-4-interacting protein 1 homolog, mitochondrial from Dictyostelium with 35.27% of identity |
---|---|
Blastx | Reticulon-4-interacting protein 1, mitochondrial from Mus with 35.85% of identity |
Eggnog | alcohol dehydrogenase(COG0604) |
Kegg | Link to kegg annotations (DDB_G0288729) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443914.1) |
Pfam | Alcohol dehydrogenase GroES-like domain (PF08240.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer