Protein coding transcript 118556

• Transcript: Ll_transcript_307202
• CDS coordinates: 256-954 (+)
• Peptide sequence: MSCNGCRVLRKGCSETCILRPCLQWIETPEAQGHATLFVAKFFGRACLMSFISNVPEIQRPALFQSLLLEACGRTVNPVNGAVGLLWTGNWHVCKAAVETVLRGGILRPVPEFIAIDAPTRTSDDASEGEVTCTDMRRLRDPNSNFQFISSSSKVSSGGKRKRLEEIDDLNLRLTPSFVQNSRAYSCRRDIRRPGSPSMNSEESVTTTAWLDSGIVDRYAHGGDRKVLNLFV*
• ORF Type: complete

Annotations of Ll_transcript_307202

• Blastp: LOB domain-containing protein 37 from Arabidopsis with 57.59% of identity
• Blastx: LOB domain-containing protein 37 from Arabidopsis with 55.64% of identity
• Eggnog: lob domain-containing protein(ENOG4111JGS)
• Kegg: Link to kegg annotations (AT5G67420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424414.1)
• Pfam: Lateral organ boundaries (LOB) domain (PF03195.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;