Protein coding transcript 118558

• Transcript: Ll_transcript_307211
• CDS coordinates: 265-963 (+)
• Peptide sequence: MSCNGCRVLRKGCSESCILRPCLQFIDTPEAQGYATVFVAKFFGRAGLMSFISNVPETQRPALFQSLLFEACGRTVNPVNGAVGLLWTGNWHVCQSAVETVLRGGTLRPMPELLALDAPTHIADDASEGEVTCTDMWRLRDPNPNFRFTSSRSKVSSSVKRKRSEEIADLNLRLSPSFVQNSPAYSCRRDIRRPETPSMNSEESVTTTACLDSGLVDRYAQGGDRKVLNLFI*
• ORF Type: complete

Annotations of Ll_transcript_307211

• Blastp: LOB domain-containing protein 39 from Arabidopsis with 55.51% of identity
• Blastx: LOB domain-containing protein 38 from Arabidopsis with 57.08% of identity
• Eggnog: Protein of unknown function DUF260(ENOG41106Y1)
• Kegg: Link to kegg annotations (AT4G37540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444914.1)
• Pfam: Lateral organ boundaries (LOB) domain (PF03195.13)
• Rfam: -
• GO: -