Protein coding transcript 118573

• Transcript: Ll_transcript_306680
• CDS coordinates: 1-417 (+)
• Peptide sequence: RLEHVLTLFAAALLEKQIVVVCSNLGILSASVLSVIPLIRPYRWQSLLMPVLPNDMLEFLDAPVPYIVGIRNKTNEVQSKLTNAVLVDLNRNQVKSPTIPPLPRHKELISSLRPYHTTLVGESYLGRRRPVYDCTEVQV
• ORF Type: internal

Annotations of Ll_transcript_306680

• Blastp: DENN domain-containing protein 5B from Danio with 33.33% of identity
• Blastx: DENN domain-containing protein 5B from Danio with 33.33% of identity
• Eggnog: DENN MADD domain containing(ENOG410XNYP)
• Kegg: Link to kegg annotations (323528)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417157.1)
• Pfam: DENN (AEX-3) domain (PF02141.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;