Protein coding transcript 118629

• Transcript: Ll_transcript_306143
• CDS coordinates: 171-1097 (+)
• Peptide sequence: MYYKQDWIGGLTAGFRILAPTTYIFFASAIPVISFGEQLERDTDGVLTAVQTLASTALCGIIHSIIGGQPLLILGVAEPTVIMYTFMFNFAKSRPELGSKLFLAWSGWVCMWTAILLFLLAILGACSIINRFTRLVGELFGLLIAMLFMQEAIKGLVNEFHIPERADPTSTEFQSSWRFGNGMFALILSFGLLLTALKSRKARSWRYGSGWLRGFIADYGVPLMIIVWTSFSYIPAGSIPKGIPRRLFSPNPWSPGAYSNWTVIKEMLNVPILYIIGAFIPATMIAVLYYFDHSVASQLAQQKEFNLRK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_306143

• Blastp: Boron transporter 1 from Arabidopsis with 85.11% of identity
• Blastx: Boron transporter 1 from Arabidopsis with 84.54% of identity
• Eggnog: solute carrier family 4(ENOG410XPHD)
• Kegg: Link to kegg annotations (AT2G47160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418825.1)
• Pfam: HCO3- transporter family (PF00955.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;