Protein coding transcript 118630

• Transcript: Ll_transcript_306144
• CDS coordinates: 564-875 (+)
• Peptide sequence: MMFKRDCCITSKNGLVVLHQDSDGVLTAVQTLASTALCGIIHSIIGGQPLLILGVAEPTVIMYIFMFNFAKSRPELGSKLFLAWSGWDSLMSFIYLREQTKHQ*
• ORF Type: complete

Annotations of Ll_transcript_306144

• Blastp: Probable boron transporter 2 from Arabidopsis with 87.14% of identity
• Blastx: Probable boron transporter 2 from Arabidopsis with 87.14% of identity
• Eggnog: solute carrier family 4(ENOG410XPHD)
• Kegg: Link to kegg annotations (AT3G62270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020976450.1)
• Pfam: HCO3- transporter family (PF00955.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;