Transcript | Ll_transcript_306760 |
---|---|
CDS coordinates | 1-969 (+) |
Peptide sequence | APTISLTSLSLSSLFRSRTKMINKNNNTYKLLLNHTSTLFLFILFSTLTVSFARHVAEDKNPFTPKASVIRYWDTHVSNNLPKPSFLLSKASPLSAVDTATFAKLAATNTLSTRLPEFCSAANLLCFPEVLPSLEKHTHDVKFSGYDDDHNFTNYGTNQAGGLDSFKNYSNGLYANPVSDFRQYSRNSAGHKEKFNSYGNDANVVDQSFHTYGTAAAGGSGEFKEYTAQSNNPDLRFSTYSDGAVGREQSFSSYSEDGNSGQQRFTSYGKGGLDADNKFKNYGTMAMEALLLQRASLITGINQMWVMIRSNLMPKTQEEVHK* |
ORF Type | 5prime_partial |
Blastp | Polygalacturonase 1 beta-like protein 3 from Arabidopsis with 52.53% of identity |
---|---|
Blastx | Polygalacturonase 1 beta-like protein 3 from Arabidopsis with 56.58% of identity |
Eggnog | Noncatalytic subunit(ENOG410YDAC) |
Kegg | Link to kegg annotations (AT1G70370) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439186.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer