Transcript | Ll_transcript_306753 |
---|---|
CDS coordinates | 3-965 (+) |
Peptide sequence | TISLTSFSLSSLFPSRTKMINKNNNTYTLLLNHTSTLFLFILFSTLTASYARHVAEDKNPFTPKASVIRHWDTHVSNNLPMPSFLLSKASPLSAIDTAMFAKLAATNTLSTRLPEFCSAANLLCFPEVLPNLEKHTHDVKFSVYDNGNNFTNYGTDRLGGVDSFKNYSNGLYVNPVNEFQEYSRNSAGHKEKFTSYGTEGNVVDQSFHTYGTAAAGGSGEFKEYTAQSNNPDLRFSTYSDGAVGREQSFSSYSEDGNSGQQRFTSYGKGGLDADNKFKNYGTMAMEALLLQRASLITGINQMWVMIRSNLMPKTQEEVHK* |
ORF Type | 5prime_partial |
Blastp | Polygalacturonase 1 beta-like protein 3 from Arabidopsis with 50.59% of identity |
---|---|
Blastx | Polygalacturonase 1 beta-like protein 3 from Arabidopsis with 54.63% of identity |
Eggnog | Noncatalytic subunit(ENOG410YDAC) |
Kegg | Link to kegg annotations (AT1G70370) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439186.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer