Protein coding transcript 118840

• Transcript: Ll_transcript_306790
• CDS coordinates: 335-652 (+)
• Peptide sequence: MSLTTTNEQLEATQMELDKVTFKSLTIDQTLEKQAEDLRSISSRYELDKKKWAEAIRSLQEKVKLMKSDYCQLSLEAHECVDSIPELNKMVFFFFLLVSSVKISK*
• ORF Type: complete

Annotations of Ll_transcript_306790

• Blastp: Kinesin-like protein KIN-14R from Arabidopsis with 54.55% of identity
• Blastx: Kinesin-like protein KIN-14R from Arabidopsis with 73.33% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT2G22610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445368.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;