Transcript | Ll_transcript_306773 |
---|---|
CDS coordinates | 97-741 (+) |
Peptide sequence | MIHFSKVKTVNSEKSKTPHSLYGGDRYHTIFYSLFHNSMVRPSVHPIEAPPLTDNAAILPRQTLKDVQGMPGTIGGFILRFFQFSFSIASLSVMSSTNDFPSVTAFRYLVAAVSLQTLWSLSLAIADIYAILVRRSYRNSRIVRLFSIGDGITSTLTFSSACASAGITVLIGNDLNDCAQNHCSRFETATAMAFMSWFAASPSFFLNFWTLASK* |
ORF Type | complete |
Blastp | CASP-like protein 5A1 from Ginkgo with 63.79% of identity |
---|---|
Blastx | CASP-like protein 5A1 from Ginkgo with 63.79% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414090.1) |
Pfam | Domain of unknown function (DUF588) (PF04535.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer