Protein coding transcript 1189

• Transcript: Ll_transcript_322343
• CDS coordinates: 3-347 (+)
• Peptide sequence: LDDIEDSAQEATSSVASAVESVTSSAIEKPTFTPTTLKAPFLEQFTDDWESRWKVSHAKKEGTEEEWTYNGKWAVEEPSVLRGIEGDKGLVLKDKAAHHAISSKFEKPITNKDDT
• ORF Type: internal

Annotations of Ll_transcript_322343

• Blastp: Calnexin homolog ARB_00147 from Trichophyton with 68.09% of identity
• Blastx: Calnexin homolog ARB_00147 from Trichophyton with 69.23% of identity
• Eggnog: Calnexin(ENOG410XP7T)
• Kegg: Link to kegg annotations (ARB_00147)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003591212.1)
• Pfam: Calreticulin family (PF00262.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;